PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016510762.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 214aa    MW: 24349.7 Da    PI: 9.0303
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016510762.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.57.1e-145397347
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +WT++E+ l++++ + +G+ +W++I++ +  +Rt  q+ s+ qky
   XP_016510762.1 53 PWTEDEHRLFLKGLEIHGKSNWAKISKDFLPNRTHIQIASHAQKY 97
                     7***************************999*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.66946102IPR017930Myb domain
SuperFamilySSF466892.44E-1549101IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-1349100IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.0E-114998IPR009057Homeodomain-like
SMARTSM007177.6E-1050100IPR001005SANT/Myb domain
CDDcd001673.49E-105398No hitNo description
PfamPF002492.0E-115397IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MAWNCTLCGG IGHNQRTCSE KGKSIKLFGV KISTTTSKKD SANYGRKIKK AIPWTEDEHR  60
LFLKGLEIHG KSNWAKISKD FLPNRTHIQI ASHAQKYFMR LAAASDERKN RKKPSIFDVH  120
LEEIIISERE TRNVSEHTIQ EHAQETGGNI PTSQVPCERA IVPLEIIQEH AQDHQEPTAI  180
SSERNHSNNF FIIPCFVPVS TWLNLPVFHS FAIN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016510762.11e-160PREDICTED: transcription factor MYB1R1-like
TrEMBLK4D8N72e-52K4D8N7_SOLLC; Uncharacterized protein
STRINGSolyc11g050730.1.16e-52(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74541230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61620.14e-25MYB_related family protein